KEGG   Taylorella equigenitalis ATCC 35865: KUI_0362
Entry
KUI_0362          CDS       T02186                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00770  Pantothenate and CoA biosynthesis
tea01100  Metabolic pathways
tea01240  Biosynthesis of cofactors
Module
tea_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KUI_0362 (coaD)
Enzymes [BR:tea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     KUI_0362 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AFN35454
UniProt: A0ABM5N9P9
LinkDB
Position
complement(383680..384198)
AA seq 172 aa
MITAIYPGTFDPITRGHEDLVRRASKLFDNVVVGVAESRAKKPFFTLEERLEIAREVLSH
YQNVEVKSFTGLLKDFVRQEGGKVIVRGLRAVSDFEYEFQLAGMNRYLLPEVETLFMTPS
EQYQFISGTFVREVAILGGNVSDFVFPLVEKRLSEKVALINSQRTQNNGTNN
NT seq 519 nt   +upstreamnt  +downstreamnt
atgattacagctatctatccgggtacatttgaccccatcactcgcggtcatgaagacttg
gtgcgccgtgcatcgaagctattcgataatgtggtcgttggagtagccgaaagtagagca
aaaaagccgttcttcacattggaggagaggctagagattgcacgggaggtgcttagtcat
tatcaaaatgtggaggttaagtctttcacaggtcttcttaaggattttgtccgccaggaa
ggcggtaaagtcatcgttcgcggtctgcgggctgtttcggattttgagtatgaatttcag
cttgccgggatgaataggtatttattgccagaggtggagactttatttatgaccccatcg
gagcaatatcaatttatatcgggcacatttgtgcgcgaggttgctattttagggggcaat
gtatccgatttcgttttcccactcgtagagaaacgtctatcagaaaaagtagcacttatt
aattcacaaaggacacaaaataatggcactaataattga

DBGET integrated database retrieval system