Terrabacter sp. C0L_2: U5C87_19945 Help Entry U5C87_19945       CDS       T09725                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ted  Terrabacter sp. C0L_2 Pathway ted00190   Oxidative phosphorylation ted01100   Metabolic pathways Module ted_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ted00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     U5C87_19945 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ted00194]     U5C87_19945 (atpE) Photosynthesis proteins [BR:ted00194]  Photosystem and electron transport system   F-type ATPase [OT]    U5C87_19945 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WVM96249 LinkDB All DBs Position complement(4286309..4286518) Genome browser AA seq 69 aa AA seqDB search MTGNIAILGYGLSAIGPGIGVGLIFAAYINGVARQPEARGMLQPIAFLGMAITEALAIFG IALAFVFKG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgactggcaacatcgccatcctcggttacggcctctccgccatcggccccggtatcggt gtcggtctgatcttcgccgcctacatcaacggcgtcgcccgtcagcccgaggcccgcggc atgctccagccgatcgccttcctcggcatggccatcaccgaggcgctcgccatcttcggt atcgcgctcgcgttcgtcttcaagggctga

DBGET integrated database retrieval system