Candidatus Tenderia electrophaga: Tel_01775 Help Entry Tel_01775         CDS       T04171                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism tee  Candidatus Tenderia electrophaga Brite KEGG Orthology (KO) [BR:tee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tee03036]     Tel_01775 Chromosome and associated proteins [BR:tee03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Tel_01775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF7310 bZIP_1 CENP-H GAS COG6_N NET2A DUF2205 YabA NRBF2 DUF7491 HALZ Asd-4 COMM_domain TSC22 DUF3287 DUF7615 Uso1_p115_C Motif Other DBs NCBI-ProteinID:  ALP51967 UniProt:  A0A0S2T9Z5 LinkDB All DBs Position complement(384333..384569) Genome browser AA seq 78 aa AA seqDB search MSQDQSRSHEQDLKSLEFRVDELIQLCHQLKSENQALREQHGSLMSERASLMKKNEAARS RVESMIMRLKNMEQEYGQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtcaggatcaatcacgcagtcatgagcaggatctcaagtccctcgaattccgggtc gatgagctgatccagctatgccatcaactgaaaagcgagaatcaggccctgcgcgagcag cacggcagtctgatgtcggaacgcgccagcctgatgaaaaagaacgaggcggcgcgctcc cgggttgagtccatgatcatgcgcttgaagaatatggaacaagaatatggccaatga

DBGET integrated database retrieval system