Candidatus Tenderia electrophaga: Tel_09460 Help Entry Tel_09460         CDS       T04171                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tee  Candidatus Tenderia electrophaga Pathway tee01100   Metabolic pathways tee01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tee00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tel_09460    00074 Mycolic acid biosynthesis     Tel_09460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tel_09460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1896 DUF1493 TMEM210 Motif Other DBs NCBI-ProteinID:  ALP54807 UniProt:  A0A0S2TI32 LinkDB All DBs Position complement(2068089..2068325) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVVEQLGVKEDEVTTEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYINSNVG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgtcaaaaagattgtcgttgagcaactaggggttaaggaa gacgaggtcaccaccgaagcttctttcgtcgatgatctgggcgcagattccctcgatacc gtggaattggtgatggcgcttgaagaagaattcgagtgtgaaattcccgatgaagaagct gaaaagatcaccaccgttcagcaggccatcgactacatcaattccaacgtgggctaa

DBGET integrated database retrieval system