Candidatus Tenderia electrophaga: Tel_13850
Help
Entry
Tel_13850 CDS
T04171
Name
(GenBank) hypothetical protein
KO
K18890
ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
tee
Candidatus Tenderia electrophaga
Pathway
tee02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
tee00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Tel_13850
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
tee02000
]
Tel_13850
Transporters [BR:
tee02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
Tel_13850
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_16
AAA_22
DUF87
nSTAND3
AAA_25
Zeta_toxin
AAA_29
SbcC_Walker_B
AAA_33
GTP_EFTU
AAA_15
Sigma54_activ_2
AAA_14
AAA_18
AAA_23
Motif
Other DBs
NCBI-ProteinID:
ALP54130
UniProt:
A0A0S2TG91
LinkDB
All DBs
Position
3043059..3044798
Genome browser
AA seq
579 aa
AA seq
DB search
MKEPTFRRLLRYALADRGLLRQALILLLIATAADVAGPLLIKVFLDDFVLPGHWPLNAML
GLGGAYVVAMIVAAASHYLQALRFNLIAQQAVQTLRQEVFAKVVHMPLGFFDRSATGALI
SRITNDTESIKELYVNVVSTFIQNLVRVLGILVAMALLDWHLMLICLLFIPLVAGLMVLY
QRLSAPLFHRARALLSDINARLHESIQGMRVIQRTHQTPRFRRDFGALADAHYQARLRNI
KLDAYILRPLVDLIQTLILIGLLFSFGYRALDTPLEIGVIYAFVAYLGRFAEPLIEITQR
LALYQQALVAGERVFELLDQRQPIATRREQAHIHAGKVELDDLRFSYDGDHEVIKGVSLT
VPPGRFCAIVGHTGSGKSTLAQLLLRFYTPQHGIIRIDDQALEDFSETELRHQVGIVQQD
PYLFNASLRDNITLGRDIDPAQLLWAAKQSGLHAHVQGLAEGYDTLMDARGAKLSTGQRQ
LLALTRALVAQPRVLILDEATANIDSHSEAQIQRALLQLHGQVTLLVIAHRLSTIERADQ
ILVMHQGEVAQRGSHGELLRQPGIYRQLYHMQTLGIEDE
NT seq
1740 nt
NT seq
+upstream
nt +downstream
nt
atgaaggagcccaccttccgccgcctgctgcgctacgccctggccgaccgtggtctgctg
cgccaggccctgatcctgctgctcatcgccaccgccgccgatgtcgccggccccttgctg
atcaaggtattcctggatgatttcgtgctgccgggccactggccgctcaatgccatgctg
ggcctgggcggggcctatgtggtggcgatgatcgtggccgccgccagccattacctacag
gcgctgcgcttcaatctcatcgcccagcaggcggtgcagaccctgcgccaagaggtcttc
gccaaggtagtgcacatgccgctgggctttttcgatcgcagcgccaccggcgccctgatt
tcgcgcatcaccaatgacaccgagtccatcaaggaactctatgtcaacgtggtgagcacc
ttcatccagaacctggtacgcgtgctgggcatcctggtggccatggccctgctggactgg
cacttgatgctcatctgcctgctgttcatcccgctggtggcaggcctgatggttctctac
cagcgcctgagcgcgcccctgttccatcgcgcccgcgccctgctcagcgacatcaatgcc
cggctgcatgaatccatccagggaatgagagtgatccagcggacccatcagacgccgcgc
ttccgccgcgatttcggtgccctggcggacgcccattatcaagcccgtctgcgcaacatc
aagctggatgcttacatcctgcgcccgctggtggatctgatccagaccctgatcctcatc
ggtctgttgttcagcttcggctatcgcgccctggatacgcccctggagatcggcgtcatc
tatgcctttgtcgcctacctggggcgcttcgccgaaccgctgatcgaaatcacccaacga
ctcgccctgtatcaacaggccctcgtcgccggcgagcgggtgttcgagttattggatcag
cgacagcccatagcgacgcggcgggagcaggcccatatccacgccggcaaggtggaattg
gatgacttgcgtttcagctacgacggtgaccacgaggtgatcaagggcgtctcgctcacc
gtcccgcccggccgtttctgcgccatcgtgggacacaccggcagcggcaagagcaccctc
gcccaactgctgttgcgcttctacacgccccagcacggcatcatccgcatcgacgatcaa
gcgctggaagacttcagcgagacggaactgcgccatcaggtcggcatcgtgcagcaggac
ccctatctgttcaacgccagcctgcgggacaacatcaccctggggcgcgacatcgacccg
gcgcagctgttgtgggccgccaagcagagcggcctacacgcccacgtgcagggcctggcc
gagggctatgacaccctgatggatgcgcgcggcgccaagctctccaccggtcagcgtcag
ctgctggccctcacccgcgccctggtggcccagccccgggtattgatcctggacgaggcc
accgccaacatcgacagtcacagcgaggcccagatccagcgcgccctgctgcagctgcac
ggccaggtcaccctgttggtgatcgcccatcgcctctccaccatcgagcgcgcggaccag
atcctggtcatgcaccaaggcgaagtggcacagcgtggcagccatggcgagctgctgcgc
cagcccggcatctaccgccagctctatcacatgcagaccttgggaatagaggacgaatag
DBGET
integrated database retrieval system