Candidatus Tenderia electrophaga: Tel_16315 Help Entry Tel_16315         CDS       T04171                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism tee  Candidatus Tenderia electrophaga Pathway tee03060   Protein export tee03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tee00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Tel_16315  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Tel_16315  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tee02044]     Tel_16315 Secretion system [BR:tee02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    Tel_16315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALP54589 UniProt:  A0A0S2THR5 LinkDB All DBs Position 3562133..3562390 Genome browser AA seq 85 aa AA seqDB search MGFGGISIWQLLIVLVIVLLLFGSKKLRGLGSDLGSAVKGFRGAMGEAEKDEDKPKDEPA KLDQADSSEARVIEGEAGERDKKKV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgggatttggtggcattagtatctggcagttgttgattgttctggtgattgtattgttg ctgttcggcagcaagaaactgcgcgggctgggctcggatctgggcagtgcggtgaagggc tttcgcggcgccatgggcgaggccgaaaaagacgaagacaagcccaaggatgaaccggcc aagttggaccaggccgacagcagcgaggcgcgggtgatcgaaggcgaggccggcgagcgg gacaagaaaaaggtttag

DBGET integrated database retrieval system