Terrilactibacillus sp. S3-3: QS257_19185 Help Entry QS257_19185       CDS       T09189                                  Name (GenBank) hypothetical protein   KO K20201   protein arginine phosphatase [EC:3.9.1.2] Organism tei  Terrilactibacillus sp. S3-3 Brite KEGG Orthology (KO) [BR:tei00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     QS257_19185 Enzymes [BR:tei01000]  3. Hydrolases   3.9  Acting on phosphorus-nitrogen bonds    3.9.1  Acting on phosphorus-nitrogen bonds (only sub-subclass identified to date)     3.9.1.2  protein arginine phosphatase      QS257_19185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LMWPc Motif Other DBs NCBI-ProteinID:  WKB35587 LinkDB All DBs Position complement(3183838..3184080) Genome browser AA seq 80 aa AA seqDB search MESILFVCTGNTCRSPMAEALMAHKAANKFRVQSAGLFAMNGAKAHPYALKALALEKEAL FFSMSRSLYRMRSLIGRRLF NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcctttttgtttgtacaggcaatacttgccgcagtccgatggccgaagct ttgatggctcataaggcggcgaataagttccgtgtgcagtccgccgggcttttcgcgatg aatggtgcaaaagcgcatccttatgcactgaaggctttggctttggaaaaagaggcgttg tttttcagcatgtcacgcagcctgtatcggatgcgctcattgattgggcgtcgcttattt taa

DBGET integrated database retrieval system