Tessaracoccus palaemonis: KDB89_08150 Help Entry KDB89_08150       CDS       T08695                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tej  Tessaracoccus palaemonis Pathway tej01100   Metabolic pathways tej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tej00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDB89_08150    00074 Mycolic acid biosynthesis     KDB89_08150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDB89_08150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXT61772 LinkDB All DBs Position 1789035..1789280 Genome browser AA seq 81 aa AA seqDB search MASTEEIRTDLAEIVNDIAGVAADDVQLDKSFIDDLGVDSLSMVEIIYACEDKFGVSIPD EDSKNLKTVGDAVAYIERASN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcaagcaccgaagagatccgcaccgacctcgccgaaatcgtcaacgacatcgccggc gtcgccgcggacgacgtccagctcgacaagtccttcatcgacgacctcggcgtcgactcc ctctcgatggtcgagatcatctacgcctgcgaggacaagttcggcgtctcgatccccgac gaggactccaagaacctcaagaccgtcggcgacgccgtcgcctacatcgagcgcgcctcc aactga

DBGET integrated database retrieval system