Tunturiibacter empetritectus: RBB75_06890
Help
Entry
RBB75_06890 CDS
T10212
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
temp Tunturiibacter empetritectus
Pathway
temp00061
Fatty acid biosynthesis
temp00620
Pyruvate metabolism
temp00640
Propanoate metabolism
temp00720
Other carbon fixation pathways
temp01100
Metabolic pathways
temp01110
Biosynthesis of secondary metabolites
temp01120
Microbial metabolism in diverse environments
temp01200
Carbon metabolism
temp01212
Fatty acid metabolism
Module
temp_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
temp00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
RBB75_06890
00640 Propanoate metabolism
RBB75_06890
09102 Energy metabolism
00720 Other carbon fixation pathways
RBB75_06890
09103 Lipid metabolism
00061 Fatty acid biosynthesis
RBB75_06890
Enzymes [BR:
temp01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
RBB75_06890
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
RBB75_06890
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Dala_Dala_lig_C
ATP-grasp
ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID:
XCB28040
UniProt:
A0AAU7ZGB0
LinkDB
All DBs
Position
complement(1670329..1671837)
Genome browser
AA seq
502 aa
AA seq
DB search
MLIANRGEIALRVIRACREIGMATVAVYSDVDRGALHVLHADEAYRLGPAPAGESYLRGD
LILEVARRTGTDAIHPGYGFLSENAEFAEACAKAGVTFIGPPASAMRVLGSKTRARQAAD
AAGMPRVPGSVTGLADVAEALRVAAGIGYPVMLKAAAGGGGKGMRAVTRAEDLGAAFTAA
SSEAERSFGSGEVYLEKLIERPRHIEIQLMADEHGSCVYLGERECSVQRRHQKVIEEAPS
AVVGDDLRRRMGEAAARLALSAGYVNAGTVEFLVDDAENFYFLEMNTRLQVEHPVTEMVT
GLDLVHLQLRLAMGEPLPLTQEDVRLRGHAIECRIYAEDPENHFFPSPGLITRLIQPSGP
GIREDCAVYEGWNVPLDYDPMLSKLVAFAPTREQAIDRMLRALGEYVIGGIKTNIGLFRR
ILMDEDFRAARIDTGYLERLLAEPAAPAQEDAQEDVPEDVVALAAALFAASARRETIGAQ
AVSGVSEESRWAVAGRREGLRL
NT seq
1509 nt
NT seq
+upstream
nt +downstream
nt
gtgttgattgcgaaccgcggggagattgcgctgcgggttattcgtgcgtgccgggagata
gggatggccacggtggcggtttactcggatgtcgaccggggggccctgcatgtgctgcac
gcggatgaggcctaccggctggggccggcgccggcgggggagagctatctgcggggggat
ctgatcctcgaggtggcgcggcggacgggtacggatgcgattcaccctgggtacgggttc
ctctcggagaatgcggagttcgccgaggcttgtgccaaggctggggtgacgttcattggg
cctccggcgagcgcgatgcgggtgcttggctcgaagaccagggcgcgacaggcggcggat
gcggcggggatgcctcgtgtcccggggagcgtgacggggctggccgatgtggccgaggcg
ctgcgcgtggccgccgggattggctatccggtgatgctgaaggctgcggctggaggcggt
ggtaagggcatgcgggcggtgacgcgggcggaggatctcggggcggcatttacggcggcc
agcagtgaggcggagcggagctttgggtcgggcgaggtgtatctggagaagctgatcgag
cggcctcggcatatcgagatccagttgatggcggatgagcatgggagctgcgtgtatctg
ggcgagcgggagtgctcggtgcagcggcggcaccagaaggtgatcgaagaggctccttcc
gcggttgtgggagatgatctgcgccgcaggatgggcgaggctgcggcgcgactggcgctc
tcggctgggtatgtgaacgctgggacggtcgagttcctggtggatgatgcggagaacttc
tacttcctggagatgaacacgcggctgcaggtggagcatcctgtgaccgagatggtgact
ggattggatctggtgcatctgcagcttcgtttggcgatgggcgagcctctgccgctgacg
caggaggatgttcggctgcgcggacacgcgattgagtgcaggatctatgcggaggaccct
gagaatcatttctttccttcgccgggattgattacgcggctgattcagccgagcggtccg
gggattcgcgaggactgcgcggtgtatgagggttggaatgtgccgctggactacgatccg
atgctgtcgaagctggtggcgtttgcgccgacgcgggagcaggctattgaccggatgctg
cgggcgctgggggagtatgttattggcgggatcaagaccaatatcgggctgttccggcgg
atcctgatggatgaagactttcgcgccgcccggattgacacggggtatctggagaggctg
ctggctgaacccgctgcccctgcgcaggaagatgcgcaggaggatgtcccggaggatgtg
gtggcgctggcggctgcgctgtttgctgcgtctgcgaggcgggaaacgatcggggcgcag
gctgtctccggtgtctctgaggagagccggtgggctgtggccgggcggcgggaggggttg
cgactgtga
DBGET
integrated database retrieval system