Tunturiibacter empetritectus: RBB75_10285
Help
Entry
RBB75_10285 CDS
T10212
Name
(GenBank) oxidoreductase
Organism
temp Tunturiibacter empetritectus
Pathway
temp00600
Sphingolipid metabolism
temp04382
Cornified envelope formation
Brite
KEGG Orthology (KO) [BR:
temp00001
]
09100 Metabolism
09103 Lipid metabolism
00600 Sphingolipid metabolism
RBB75_10285
09150 Organismal Systems
09158 Development and regeneration
04382 Cornified envelope formation
RBB75_10285
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short
adh_short_C2
KR
NAD_binding_10
Epimerase
DUF1776
DFP
F420_oxidored
Motif
Other DBs
NCBI-ProteinID:
XCB24847
UniProt:
A0AAU7Z7W8
LinkDB
All DBs
Position
2547160..2548170
Genome browser
AA seq
336 aa
AA seq
DB search
MFEAERIADGSCILYRFDGVGAERDGVAAFPSAAVRALIDSGQEAQPFGVLEKMTQSIQR
VWFITGASTGFGRLLAEEVLKSGGKVVATARRLEKIADLEREYPQSAKALTLDVTDAGQV
DSAVTQAFAQFGQVDVLVNNAGYGVAGAIEEVSEAEFMPMFETNVFGLLRVTRAFLPHLR
KQRSGHILNLSSIGGLIGGQGIGMYNASKFAVEGLSEALAAELAPLGIRVTVIEPGPFRT
DFLGRSGVVAKTKISDYDNTAGNMRKYFAENDGKQKGDPLRAVQAMMEVVESPNPPLHLL
LGVSALQRFRGKLENWQKEIAAWEPLTVGADFPEGE
NT seq
1011 nt
NT seq
+upstream
nt +downstream
nt
atgtttgaggcggagaggatcgcggacggatcatgcatcctgtatcgctttgacggagtc
ggcgcggagagagacggtgttgccgcttttccttcggcggccgtacgggctctcattgat
tcgggccaggaggcgcagccctttggagtactggagaagatgactcaatcgattcaacgt
gtgtggtttattacgggagcatcgaccggctttggccgtctgcttgccgaagaggttctg
aagtctggcggcaaagtagtggcgacagccaggagactggagaagattgcggatcttgaa
agagagtatccgcagagtgcgaaggctttgacgcttgatgtgacagatgccggccaggta
gattcggccgtgacgcaggcctttgcgcagttcgggcaggtagatgttctggtcaacaat
gcgggctatggggttgccggcgcgattgaagaggtctcggaggcggagtttatgccgatg
ttcgagaccaatgtcttcggtttgttgagggtgacgcgggcgtttctccctcatctgcgg
aagcagcgcagcggacatattctgaacctgtcttcgatcggcggtttgattggcggacag
ggcatcgggatgtataacgcgagcaagtttgcggtggaggggctgtcggaggctctggct
gcagagcttgcgccgctgggcattcgcgttacggtgattgagccgggtccgtttcgcact
gattttttggggcgctcgggtgtggtggctaagactaagatttcggactacgacaacacg
gctggaaatatgcgtaaatactttgccgagaatgatggcaagcagaagggcgatccgttg
cgtgcggttcaggcgatgatggaggttgtggagtcgccgaatccaccgctgcatcttctg
ctgggggtgagcgcgctgcagcggtttcgcggcaagctggagaactggcagaaggagatt
gcagcgtgggagccgttgacggttggagcagattttccggagggtgagtga
DBGET
integrated database retrieval system