KEGG   Tunturiibacter empetritectus: RBB75_10285
Entry
RBB75_10285       CDS       T10212                                 
Name
(GenBank) oxidoreductase
Organism
temp  Tunturiibacter empetritectus
Pathway
temp00600  Sphingolipid metabolism
temp04382  Cornified envelope formation
Brite
KEGG Orthology (KO) [BR:temp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    RBB75_10285
 09150 Organismal Systems
  09158 Development and regeneration
   04382 Cornified envelope formation
    RBB75_10285
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase DUF1776 DFP F420_oxidored
Other DBs
NCBI-ProteinID: XCB24847
UniProt: A0AAU7Z7W8
LinkDB
Position
2547160..2548170
AA seq 336 aa
MFEAERIADGSCILYRFDGVGAERDGVAAFPSAAVRALIDSGQEAQPFGVLEKMTQSIQR
VWFITGASTGFGRLLAEEVLKSGGKVVATARRLEKIADLEREYPQSAKALTLDVTDAGQV
DSAVTQAFAQFGQVDVLVNNAGYGVAGAIEEVSEAEFMPMFETNVFGLLRVTRAFLPHLR
KQRSGHILNLSSIGGLIGGQGIGMYNASKFAVEGLSEALAAELAPLGIRVTVIEPGPFRT
DFLGRSGVVAKTKISDYDNTAGNMRKYFAENDGKQKGDPLRAVQAMMEVVESPNPPLHLL
LGVSALQRFRGKLENWQKEIAAWEPLTVGADFPEGE
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtttgaggcggagaggatcgcggacggatcatgcatcctgtatcgctttgacggagtc
ggcgcggagagagacggtgttgccgcttttccttcggcggccgtacgggctctcattgat
tcgggccaggaggcgcagccctttggagtactggagaagatgactcaatcgattcaacgt
gtgtggtttattacgggagcatcgaccggctttggccgtctgcttgccgaagaggttctg
aagtctggcggcaaagtagtggcgacagccaggagactggagaagattgcggatcttgaa
agagagtatccgcagagtgcgaaggctttgacgcttgatgtgacagatgccggccaggta
gattcggccgtgacgcaggcctttgcgcagttcgggcaggtagatgttctggtcaacaat
gcgggctatggggttgccggcgcgattgaagaggtctcggaggcggagtttatgccgatg
ttcgagaccaatgtcttcggtttgttgagggtgacgcgggcgtttctccctcatctgcgg
aagcagcgcagcggacatattctgaacctgtcttcgatcggcggtttgattggcggacag
ggcatcgggatgtataacgcgagcaagtttgcggtggaggggctgtcggaggctctggct
gcagagcttgcgccgctgggcattcgcgttacggtgattgagccgggtccgtttcgcact
gattttttggggcgctcgggtgtggtggctaagactaagatttcggactacgacaacacg
gctggaaatatgcgtaaatactttgccgagaatgatggcaagcagaagggcgatccgttg
cgtgcggttcaggcgatgatggaggttgtggagtcgccgaatccaccgctgcatcttctg
ctgggggtgagcgcgctgcagcggtttcgcggcaagctggagaactggcagaaggagatt
gcagcgtgggagccgttgacggttggagcagattttccggagggtgagtga

DBGET integrated database retrieval system