Tunturiibacter empetritectus: RBB75_11580 Help Entry RBB75_11580       CDS       T10212                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism temp  Tunturiibacter empetritectus Pathway temp01100   Metabolic pathways temp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:temp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBB75_11580    00074 Mycolic acid biosynthesis     RBB75_11580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBB75_11580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XCB25096 UniProt:  A0AAU7Z9N4 LinkDB All DBs Position complement(2834004..2834246) Genome browser AA seq 80 aa AA seqDB search MDDRLPEVQEIFRDVFDSPTLIITRESSAYNVEGWDSLAHIDLVTAIETRYKIKFALGEL EELKNVGDLLDLIDAKMRVK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatgatcgtttgcccgaagtacaagaaatttttcgcgatgtctttgattcgcccacg ctcattattactcgtgagtcaagtgcctataacgtggagggctgggactctttagcacat atcgatcttgttactgcgatcgagacgagatataaaattaagttcgccctcggcgagcta gaagagcttaagaacgtcggcgatctcttggaccttattgatgccaaaatgcgcgtaaag taa

DBGET integrated database retrieval system