Tepidanaerobacter acetatoxydans Re1: TepRe1_1323 Help Entry TepRe1_1323       CDS       T01495                                  Name (GenBank) Protein hfq   KO K03666   host factor-I protein Organism tep  Tepidanaerobacter acetatoxydans Re1 Pathway tep02024   Quorum sensing tep03018   RNA degradation Brite KEGG Orthology (KO) [BR:tep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     TepRe1_1323  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     TepRe1_1323  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tep03019]     TepRe1_1323    03036 Chromosome and associated proteins [BR:tep03036]     TepRe1_1323 Messenger RNA biogenesis [BR:tep03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      TepRe1_1323 Chromosome and associated proteins [BR:tep03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     TepRe1_1323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AEE91469 UniProt:  F4LUD9 LinkDB All DBs Position 1369940..1370197 Genome browser AA seq 85 aa AA seqDB search MTKVQINLQDSFLNQIRKDNIPVTIYLVNGFQLKGMVRGFDNFTIVLDSDGKQQLVYKHA VSTIAPLRTINLNQGMIDQRKTDED NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagtacaaattaatcttcaggatagttttttgaatcagatcaggaaggacaat atccctgtgacaatatatcttgttaatgggtttcagttaaaaggtatggtacggggtttt gataattttacaattgttcttgattctgacggcaaacaacagttagtatataagcatgca gtttctaccatagcacctttaagaacgattaatttaaatcagggtatgatagaccaacgg aaaacagatgaagattaa

DBGET integrated database retrieval system