Tepidanaerobacter acetatoxydans Re1: TepRe1_1775 Help Entry TepRe1_1775       CDS       T01495                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism tep  Tepidanaerobacter acetatoxydans Re1 Pathway tep01100   Metabolic pathways tep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TepRe1_1775    00074 Mycolic acid biosynthesis     TepRe1_1775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TepRe1_1775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF4358 Motif Other DBs NCBI-ProteinID:  AEE91906 UniProt:  F4LXA7 LinkDB All DBs Position complement(1831846..1832076) Genome browser AA seq 76 aa AA seqDB search MEFKEFLAELADLLEVDAEDLNDDYELDSENFDSVAVVSTIALIDEYFDVTVNGKSLSQA KTVGEVMDLIKKAKED NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaatttaaggaatttttagcggaacttgcagatttattagaggtagatgcagaagat ttaaatgatgattacgaattagatagcgaaaattttgattcagtcgctgtagtatctact atagctttaatcgatgaatattttgatgtaacagtcaacggaaagtcactgtcacaggcc aaaacagtgggagaagtaatggatttaataaaaaaagcaaaagaggattaa

DBGET integrated database retrieval system