Trichodesmium erythraeum: Tery_0468 Help Entry Tery_0468         CDS       T00387                                  Name (GenBank) hypothetical protein   KO K01809   mannose-6-phosphate isomerase [EC:5.3.1.8] Organism ter  Trichodesmium erythraeum Pathway ter00051   Fructose and mannose metabolism ter00520   Amino sugar and nucleotide sugar metabolism ter01100   Metabolic pathways ter01110   Biosynthesis of secondary metabolites ter01240   Biosynthesis of cofactors ter01250   Biosynthesis of nucleotide sugars Module ter_M01000   GDP-Man biosynthesis, Fru-6P => GDP-Man Brite KEGG Orthology (KO) [BR:ter00001]  09100 Metabolism   09101 Carbohydrate metabolism    00051 Fructose and mannose metabolism     Tery_0468   09107 Glycan biosynthesis and metabolism    00520 Amino sugar and nucleotide sugar metabolism     Tery_0468 Enzymes [BR:ter01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.8  mannose-6-phosphate isomerase      Tery_0468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MannoseP_isomer Motif Other DBs NCBI-ProteinID:  ABG49924 UniProt:  Q119A0 LinkDB All DBs Position 747158..747436 Genome browser AA seq 92 aa AA seqDB search MGEFLALKQLEISEVIPLVLIELKNKEYLREDDIINCQNNYPRTNSLNILVSKKKFLMIN LSAPAAQEIIPLQSKQNHSNVLFHLKVKPSGS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgggtgagtttcttgcactgaaacaattagagatatcagaagttattcctctagtatta attgagttaaaaaataaagagtatcttagagaggatgacattattaattgtcaaaataat tatcctcgaacaaactccttaaatatacttgtaagtaaaaaaaaatttttaatgattaac ttaagtgcaccagcagcccaagagattattcctcttcagtccaaacaaaatcattcaaat gtcttatttcatctaaaagttaaacctagtggttcctag

DBGET integrated database retrieval system