Trichodesmium erythraeum: Tery_1172 Help Entry Tery_1172         CDS       T00387                                  Name (GenBank) conserved hypothetical protein   KO K03666   host factor-I protein Organism ter  Trichodesmium erythraeum Pathway ter02024   Quorum sensing ter03018   RNA degradation Brite KEGG Orthology (KO) [BR:ter00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Tery_1172  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Tery_1172  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ter03019]     Tery_1172    03036 Chromosome and associated proteins [BR:ter03036]     Tery_1172 Messenger RNA biogenesis [BR:ter03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Tery_1172 Chromosome and associated proteins [BR:ter03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Tery_1172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Motif Other DBs NCBI-ProteinID:  ABG50532 UniProt:  Q116P2 LinkDB All DBs Position complement(1833562..1833774) Genome browser AA seq 70 aa AA seqDB search MSDFDTSLPSTRQIQTYIQEKKEVEIKLITNDLYVGKVFWQDPNCICLFGQYDSPILIWR QSIVYLKAKN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgattttgatacaagtttaccaagtactcgccaaattcaaacctacattcaagag aaaaaagaagtagaaataaaactaattactaatgacctttatgtaggaaaagttttctgg caagatccaaattgtatctgcctcttcggtcagtatgactcaccaattttaatttggcga caatctattgtttatctcaaagcaaaaaactaa

DBGET integrated database retrieval system