Trichodesmium erythraeum: Tery_1610 Help Entry Tery_1610         CDS       T00387                                  Name (GenBank) bacterial nucleoid protein Hbs   KO K03530   DNA-binding protein HU-beta Organism ter  Trichodesmium erythraeum Brite KEGG Orthology (KO) [BR:ter00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ter03032]     Tery_1610    03036 Chromosome and associated proteins [BR:ter03036]     Tery_1610    03400 DNA repair and recombination proteins [BR:ter03400]     Tery_1610 DNA replication proteins [BR:ter03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Tery_1610 Chromosome and associated proteins [BR:ter03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     Tery_1610 DNA repair and recombination proteins [BR:ter03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       Tery_1610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ABG50889 UniProt:  Q115D5 LinkDB All DBs Position 2465013..2465300 Genome browser AA seq 95 aa AA seqDB search MNKGELVDEISKKAEVTKKQADAVLSAALEAIMDAVASGDKVTLVGFGSFESRERKAREG RNPKTGDKMEIPETTVPAFSAGKSFKELVAERNGK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggtgaattagttgatgaaatatcaaaaaaagctgaagtcacgaaaaagcaa gccgatgctgtactaagtgcagccctagaagctataatggatgctgtggctagcggggac aaagttaccttagttggttttggttcatttgaatctagagaacgtaaagccagagagggc cgtaatcccaaaacaggtgacaaaatggaaatacctgaaactacagtgcctgctttttct gcgggcaaatctttcaaagagttagttgccgaaagaaacggtaaataa

DBGET integrated database retrieval system