Tessaracoccus aquimaris: BW730_09960 Help Entry BW730_09960       CDS       T04732                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism tes  Tessaracoccus aquimaris Pathway tes00400   Phenylalanine, tyrosine and tryptophan biosynthesis tes01100   Metabolic pathways tes01110   Biosynthesis of secondary metabolites tes01230   Biosynthesis of amino acids Module tes_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine tes_M00025   Tyrosine biosynthesis, chorismate => HPP => tyrosine Brite KEGG Orthology (KO) [BR:tes00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BW730_09960 Enzymes [BR:tes01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BW730_09960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  AQP49311 UniProt:  A0A1Q2CT59 LinkDB All DBs Position complement(2117732..2118034) Genome browser AA seq 100 aa AA seqDB search MTQDEARAELRRLRGSIDNMDSALVHLLAERFKVTQRVGELKAAAGLPPADPDREAAQIA RLRALAVDADLDPEFAEKFLTFIVTEVVRHHEQIAAEQGE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgacgcaggacgaggcgagggcggagctccggcggctgcgcgggagcatcgacaacatg gactcggccctcgtgcacctgctcgccgagcgcttcaaggtcacccagcgggtcggcgag ttgaaggccgccgcaggcctaccgcccgcagatccggaccgtgaggccgcccagatcgcc cggctgcgggcgttggcggtcgacgcggacctcgacccggagttcgcggagaagttcctg acgttcatcgtcacggaggtcgtgcggcatcacgagcagatcgcggccgaacagggcgag tag

DBGET integrated database retrieval system