Tetrahymena thermophila: TTHERM_000649439 Help Entry TTHERM_000649439  CDS       T01020                                  Name (RefSeq) cytoplasmic dynein light chain 2   KO K10418   dynein light chain LC8-type Organism tet  Tetrahymena thermophila Pathway tet04814   Motor proteins Brite KEGG Orthology (KO) [BR:tet00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     TTHERM_000649439  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tet03037]     TTHERM_000649439    04812 Cytoskeleton proteins [BR:tet04812]     TTHERM_000649439 Cilium and associated proteins [BR:tet03037]  Motile cilia and associated proteins   Dynein arm    TTHERM_000649439 Cytoskeleton proteins [BR:tet04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      TTHERM_000649439 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Imm48 CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  24440031 NCBI-ProteinID:  XP_012653183 TGD:  TTHERM_000649439 UniProt:  W7X4R1 LinkDB All DBs AA seq 91 aa AA seqDB search MAQADRKAVIKNADMAEEMSQDAIDCANQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIV GRNFGSYVTHETKHFIYFYMGQVAILLFKSG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcttaagctgacagaaaagcagttattaagaatgcagatatggcagaagaaatgtca taagatgccatcgattgcgccaatcaagctttggaaaaatttaatattgaaaaagatatt gccgctttcatcaaaaaggaattcgacaagaagtacaatcctacttggcattgtattgtc ggaagaaacttcggttcttacgtcactcacgaaactaagcattttatttatttctatatg ggttaggtggctattttgctatttaagtctggttga

DBGET integrated database retrieval system