Thermococcus eurythermalis: TEU_03985 Help Entry TEU_03985         CDS       T03421                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism teu  Thermococcus eurythermalis Pathway teu03010   Ribosome Brite KEGG Orthology (KO) [BR:teu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TEU_03985   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TEU_03985  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:teu03011]     TEU_03985    04121 Ubiquitin system [BR:teu04121]     TEU_03985   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:teu04147]     TEU_03985 Ribosome [BR:teu03011]  Ribosomal proteins   Eukaryotes    Small subunit     TEU_03985   Archaea     TEU_03985 Ubiquitin system [BR:teu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TEU_03985 Exosome [BR:teu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TEU_03985   Exosomal proteins of colorectal cancer cells    TEU_03985 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_NUD Zn_ribbon_IS1595 Cas12f1-like_TNB GFA Zn_ribbon_RPB9 YOR011W-A Motif Other DBs NCBI-ProteinID:  AIU69566 UniProt:  A0A097QSX3 LinkDB All DBs Position 752246..752416 Genome browser AA seq 56 aa AA seqDB search MAKKKKTSQKWKLYEVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKK NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaagaaaaagaccagccagaagtggaagctctatgaggttaaggacggaaag gtcatcaggaagaacaagttctgcccgcgctgcggccccggcgtcttcatggccgaccac ggcgaccgctgggcctgcggaaggtgcggctacaccgagtggaagaagtga

DBGET integrated database retrieval system