Thermococcus eurythermalis: TEU_05325 Help Entry TEU_05325         CDS       T03421                                  Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism teu  Thermococcus eurythermalis Pathway teu03010   Ribosome Brite KEGG Orthology (KO) [BR:teu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TEU_05325   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TEU_05325  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:teu03011]     TEU_05325    04121 Ubiquitin system [BR:teu04121]     TEU_05325 Ribosome [BR:teu03011]  Ribosomal proteins   Eukaryotes    Large subunit     TEU_05325   Archaea     TEU_05325 Ubiquitin system [BR:teu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TEU_05325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 DZR Ribosomal_L40e Zn_ribbon_3 UPF0547 Toxin_5 DZR_2 Zn_ribbon_RPAB4 DUF7577 Motif Other DBs NCBI-ProteinID:  AIU69801 UniProt:  A0A097QTI6 LinkDB All DBs Position 967302..967457 Genome browser AA seq 51 aa AA seqDB search MARFPEAEARIFRKLICMRCGATNPWGAKKCRKCGYKGLRPKAREPRGGGR NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggcgagattccccgaagctgaagcaagaatcttcaggaagcttatctgcatgcgttgc ggcgccaccaacccgtggggcgcaaagaagtgcagaaagtgcggatacaaggggctccgc cccaaggccagagaaccgcgcggtggcggacgctga

DBGET integrated database retrieval system