Thermoanaerobacter sp. X514: Teth514_1722 Help Entry Teth514_1722      CDS       T00648                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tex  Thermoanaerobacter sp. X514 Pathway tex01100   Metabolic pathways tex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Teth514_1722    00074 Mycolic acid biosynthesis     Teth514_1722   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Teth514_1722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  ABY93008 UniProt:  B0K1W0 LinkDB All DBs Position complement(1730679..1730906) Genome browser AA seq 75 aa AA seqDB search MIFEKVRDIIAEQLGIDPEEITMESSFIDDLGADSLDIVELIMALEEEFDIEIPDEDAEK IKTVGDVVEYLSNLE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatttttgaaaaagtaagggacataatagccgaacaactcggcattgatccagaggaa ataacgatggagtcatcttttatagatgatttaggagcagactctttggacatagtagag ctcataatggctctggaagaagagtttgatattgaaattcctgatgaagatgctgaaaag attaaaacggtaggtgatgtagtagaatacttaagcaatcttgaataa

DBGET integrated database retrieval system