Tessaracoccus sp. T2.5-30: BKM78_14745 Help Entry BKM78_14745       CDS       T04747                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tez  Tessaracoccus sp. T2.5-30 Pathway tez01100   Metabolic pathways tez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKM78_14745    00074 Mycolic acid biosynthesis     BKM78_14745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKM78_14745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AQX17033 UniProt:  A0A807N8I3 LinkDB All DBs Position complement(3199446..3199691) Genome browser AA seq 81 aa AA seqDB search MASTEEIRTDLAEIVNDIAGVAVEDVQLDKSFVDDLGVDSLSMVEIIYACEDKFGVSIPD EDAKNLKTVGDAVAYIERAAN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccagcactgaagagatccgcaccgacctcgccgagatcgtcaacgacatcgccggc gtcgccgtggaggacgtccagctcgacaagtccttcgtggacgacctcggcgtcgactcg ctgtcgatggtcgagatcatctacgcctgcgaggacaagttcggcgtgtccatccccgac gaggacgccaagaacctcaagaccgtgggcgacgcggtcgcctacatcgagcgcgccgcc aactga

DBGET integrated database retrieval system