Tachysurus fulvidraco (yellow catfish): 113634170 Help Entry 113634170         CDS       T08119                                  Name (RefSeq) ubiquitin   KO K04551   ubiquitin B Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04120   Ubiquitin mediated proteolysis tfd04137   Mitophagy - animal tfd04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113634170  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113634170    04137 Mitophagy - animal     113634170  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tfd04121]     113634170   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113634170 Ubiquitin system [BR:tfd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    113634170 Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of breast milk    113634170   Exosomal proteins of other body fluids (saliva and urine)    113634170   Exosomal proteins of colorectal cancer cells    113634170   Exosomal proteins of bladder cancer cells    113634170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD TBK1_ULD DUF2604 UBL_UBAC1 Ubiquitin_5 DUF7011 Motif Other DBs NCBI-GeneID:  113634170 NCBI-ProteinID:  XP_026988744 LinkDB All DBs Position 26:complement(5548741..5550130) Genome browser AA seq 152 aa AA seqDB search MQIFVKTLTGKTITLDVEPSDIIELVKAKIQDKEDIPPEEQRLLFGGKQLEDGRTLSEYN IQKESTLHLVLRLRGGMQIFVKMLTGKTITFEIESNDTIENIKAKIQDKEDILPGQQRLI FDGQQLEDGHTLLDYNIQKESTLYLVQRLRGG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaaaacccttactggaaagaccatcacccttgacgttgagccaagt gacatcattgagctcgtcaaggccaaaatccaggacaaagaagacattcccccagaagag cagaggctgctctttggtggcaaacagctggaggatggtcgcaccctgtctgagtacaac atccagaaggagtccaccctccacctggtcctccgcctgaggggtggcatgcagatcttt gtgaagatgctgactggcaagacaatcaccttcgagattgagtcaaatgacaccattgag aacatcaaggccaaaatccaggacaaagaagacatccttccaggtcagcagaggttgata tttgatggacaacagctggaagatggtcacaccctgttagactacaacatccagaaggag tccaccctctaccttgtccaacgcctcaggggtggatag

DBGET integrated database retrieval system