Tachysurus fulvidraco (yellow catfish): 113635921 Help Entry 113635921         CDS       T08119                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04080   Neuroactive ligand-receptor interaction tfd04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     113635921 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     113635921 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tfd04052]     113635921 (apln) Cytokines and neuropeptides [BR:tfd04052]  Neuropeptides   GPCR binding    113635921 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Gastrin LYRIC Motif Other DBs NCBI-GeneID:  113635921 NCBI-ProteinID:  XP_026991478 LinkDB All DBs Position 17:complement(12294203..12317652) Genome browser AA seq 77 aa AA seqDB search MNVKILTLVIVLLLSLLCSACAGPVTSTEHSKELEEVGSMKTPVRQNPARAGRNQRPSGW RRRRPRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctgctgctttctctgctgtgttcagcc tgtgctggtccagtgacctccaccgagcatagcaaggagttggaggaggtgggaagcatg aagactcctgtgcgtcagaaccctgcccgagctggacggaaccaaagaccctccggctgg aggaggaggcgccctcgaccccgcctgtcccacaaggggcccatgccattttag

DBGET integrated database retrieval system