Tachysurus fulvidraco (yellow catfish): 113641175 Help Entry 113641175         CDS       T08119                                  Symbol zgc:55558 Name (RefSeq) GTPase KRas isoform X7   KO K07828   GTPase NRas Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04010   MAPK signaling pathway tfd04012   ErbB signaling pathway tfd04068   FoxO signaling pathway tfd04137   Mitophagy - animal tfd04140   Autophagy - animal tfd04150   mTOR signaling pathway tfd04210   Apoptosis tfd04218   Cellular senescence tfd04370   VEGF signaling pathway tfd04371   Apelin signaling pathway tfd04540   Gap junction tfd04625   C-type lectin receptor signaling pathway tfd04810   Regulation of actin cytoskeleton tfd04910   Insulin signaling pathway tfd04912   GnRH signaling pathway tfd04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113641175 (zgc:55558)    04012 ErbB signaling pathway     113641175 (zgc:55558)    04370 VEGF signaling pathway     113641175 (zgc:55558)    04371 Apelin signaling pathway     113641175 (zgc:55558)    04068 FoxO signaling pathway     113641175 (zgc:55558)    04150 mTOR signaling pathway     113641175 (zgc:55558)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113641175 (zgc:55558)    04137 Mitophagy - animal     113641175 (zgc:55558)   09143 Cell growth and death    04210 Apoptosis     113641175 (zgc:55558)    04218 Cellular senescence     113641175 (zgc:55558)   09144 Cellular community - eukaryotes    04540 Gap junction     113641175 (zgc:55558)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113641175 (zgc:55558)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113641175 (zgc:55558)   09152 Endocrine system    04910 Insulin signaling pathway     113641175 (zgc:55558)    04912 GnRH signaling pathway     113641175 (zgc:55558)    04916 Melanogenesis     113641175 (zgc:55558)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfd04131]     113641175 (zgc:55558)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113641175 (zgc:55558)    04031 GTP-binding proteins [BR:tfd04031]     113641175 (zgc:55558) Membrane trafficking [BR:tfd04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113641175 (zgc:55558)  Endocytosis   Macropinocytosis    Ras GTPases     113641175 (zgc:55558) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113641175 (zgc:55558)   Exosomal proteins of other body fluids (saliva and urine)    113641175 (zgc:55558)   Exosomal proteins of breast cancer cells    113641175 (zgc:55558)   Exosomal proteins of colorectal cancer cells    113641175 (zgc:55558) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113641175 (zgc:55558) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  113641175 NCBI-ProteinID:  XP_026999554 LinkDB All DBs Position 15:17458937..17466526 Genome browser AA seq 173 aa AA seqDB search MEKAVQDEMEKAVQDEMEKAGQDETRKAVQDETGKAVQDETGKAVQDETGKAVQDETGKA VQDETGKAVQDETGKAVQDETGKAVHGKAVHGKAVQDKALQDKADSYRKQVVIDGETCLL DILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNIKSFADVHLYSPCFLCVGSR NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggaaaaggcggtgcaggacgagatggaaaaggcggtgcaggatgagatggaaaaggcg gggcaggacgagacgagaaaggcggtgcaggacgagacaggaaaggcggtgcaggacgag acaggaaaggcggtgcaggacgagacaggaaaggcggtgcaggacgagacaggaaaggcg gtgcaggacgagacaggaaaggcggtgcaggacgagacaggaaaggcggtgcaggacgag acaggaaaggcggtgcatggaaaggcggtgcatggaaaggcggtgcaggacaaggcgttg caggacaaggcggactcgtacaggaagcaggtggtgatcgatggcgagacgtgtctcctg gacatcctcgataccgcaggtcaggaggagtacagcgccatgagggatcagtacatgagg accggcgagggcttcctctgcgtgtttgccatcaataatataaagtctttcgcggatgtg catctctacagcccctgttttctgtgtgtagggagcagataa

DBGET integrated database retrieval system