Tachysurus fulvidraco (yellow catfish): 113641937 Help Entry 113641937         CDS       T08119                                  Symbol cdc42l2 Name (RefSeq) cell division cycle 42 like 2   KO K04393   cell division control protein 42 Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04010   MAPK signaling pathway tfd04144   Endocytosis tfd04370   VEGF signaling pathway tfd04510   Focal adhesion tfd04517   IgSF CAM signaling tfd04518   Integrin signaling tfd04520   Adherens junction tfd04530   Tight junction tfd04810   Regulation of actin cytoskeleton tfd04912   GnRH signaling pathway tfd05100   Bacterial invasion of epithelial cells tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113641937 (cdc42l2)    04370 VEGF signaling pathway     113641937 (cdc42l2)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113641937 (cdc42l2)    04518 Integrin signaling     113641937 (cdc42l2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113641937 (cdc42l2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     113641937 (cdc42l2)    04520 Adherens junction     113641937 (cdc42l2)    04530 Tight junction     113641937 (cdc42l2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113641937 (cdc42l2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     113641937 (cdc42l2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113641937 (cdc42l2)    05100 Bacterial invasion of epithelial cells     113641937 (cdc42l2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfd04131]     113641937 (cdc42l2)    03036 Chromosome and associated proteins [BR:tfd03036]     113641937 (cdc42l2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113641937 (cdc42l2)    04031 GTP-binding proteins [BR:tfd04031]     113641937 (cdc42l2) Membrane trafficking [BR:tfd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113641937 (cdc42l2)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     113641937 (cdc42l2)   Macropinocytosis    Ras GTPases     113641937 (cdc42l2) Chromosome and associated proteins [BR:tfd03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     113641937 (cdc42l2) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of microglial cells    113641937 (cdc42l2)   Exosomal proteins of breast milk    113641937 (cdc42l2) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113641937 (cdc42l2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  113641937 NCBI-ProteinID:  XP_027000935 LinkDB All DBs Position 23:complement(10759595..10766234) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKKPKCLLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgattaaatgtgtagtagttggtgatggtgctgtgggtaaaacctgcctcttg atttcatacaccacaaacaagttcccttcggagtacgtacccacagtctttgataactat gctgtaactgtaatgatcggcggggaaccttacactctcggattatttgacaccgcaggt caggaagattatgatcggttgcgacccctgagctatccccaaactgatgtcttcttagtt tgtttctctgtagtttcaccatcatcttttgaaaatgtcaaggaaaaatgggttcctgag attacccatcactgtccaaagaccccattcctgctggtcgggactcagattgacttacga gacgatccctcaaccattgagaagcttgccaagaacaagcagaaacctattactccagag acagctgagaaactcgccagggatttaaaagcagtgaaatatgtggaatgttcagcttta acacaaaaagggctaaagaatgtgttcgatgaggccatactcgctgcgctggagccccca gagcccaagaagaagcccaaatgtcttcttttatga

DBGET integrated database retrieval system