Tachysurus fulvidraco (yellow catfish): 113641959 Help Entry 113641959         CDS       T08119                                  Name (RefSeq) protein BTG1-like   KO K14443   protein Tob/BTG Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd03018   RNA degradation Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     113641959  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tfd03019]     113641959 Messenger RNA biogenesis [BR:tfd03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      113641959   mRNA degradation factors    3'-5' decay     Other 3'-5' decay factors      113641959 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BTG Motif Other DBs NCBI-GeneID:  113641959 NCBI-ProteinID:  XP_047663504 LinkDB All DBs Position 23:9161952..9163021 Genome browser AA seq 114 aa AA seqDB search MKTEVSTAADFVTSLVRMTGLLTEDRLHHFSFSLQKTLLDYYEKHWFPQDPCRGSGYRCL QINHKMDPLLNKAARAVGITKEERFVLFPCELTVWVDPHEVSYRISENGSSCVP NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaaaacagaagtctctacggctgctgacttcgttaccagtctggtcaggatgactggc cttcttactgaagatcgtcttcatcactttagcttttccctgcagaagacgctacttgat tactatgagaaacactggtttccccaagacccttgcagagggtcaggctacaggtgcttg cagataaaccacaaaatggaccctttgttaaacaaagctgcccgggctgttggcattaca aaggaggaacgttttgtcttgtttccatgcgagctgacagtgtgggtggacccgcacgaa gtgtcttatcgcatcagtgaaaatggatccagttgtgtcccttag

DBGET integrated database retrieval system