Tachysurus fulvidraco (yellow catfish): 113642822 Help Entry 113642822         CDS       T08119                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04137   Mitophagy - animal tfd04140   Autophagy - animal tfd04144   Endocytosis tfd04145   Phagosome tfd04148   Efferocytosis tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113642822    04145 Phagosome     113642822    04140 Autophagy - animal     113642822    04137 Mitophagy - animal     113642822    04148 Efferocytosis     113642822  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113642822  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfd04131]     113642822   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113642822    04031 GTP-binding proteins [BR:tfd04031]     113642822 Membrane trafficking [BR:tfd04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113642822 Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113642822   Exosomal proteins of other body fluids (saliva and urine)    113642822   Exosomal proteins of colorectal cancer cells    113642822   Exosomal proteins of bladder cancer cells    113642822 GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113642822 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW nSTAND3 PduV-EutP Septin AAA_16 NTPase_1 AAA_7 AAA_24 AAA_22 AAA_5 ATPase_2 NACHT NB-ARC ABC_tran AAA_14 ATP-synt_ab Peptidase_M9 Motif Other DBs NCBI-GeneID:  113642822 NCBI-ProteinID:  XP_027002309 LinkDB All DBs Position 5:complement(15534604..15539331) Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAHGTFKTLDSWRDEFLIQAGPRDPDNFPF LVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETDL DTGIEIPDQIKLDRNDISSSSEQSCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatcaaggaagaaagttcttctaaaagtcattattcttggggattcaggagttgga aagacgtctttaatgaaccagtatgttaacaagaaattcagtaatcagtacaaagctaca ataggagctgacttccttacaaaggaggtgatggttgaggacagacttgttactttgcag atttgggacacagctggacaggaaaggtttcagtctcttggggtcgcgttttatcgaggt gctgactgctgtgtgctggtattcgatgttactgctcatggcacatttaagacactggat tcctggagagatgagtttttgattcaggctggtcctcgtgacccagacaacttccctttc ctggtcctaggcaacaagattgacctggaaaacaggcaggtgacaacaaagcgggcacag gcatggtgtcagagtaaaaacaatattccatactttgaaaccagcgcaaaggaggccatc aatgttgaacaggcatttcaaaccattgcacgtaatgctttaaaacaggaaacagacctt gatacaggtattgaaattccagatcagattaagttggacagaaatgacatctccagctca tctgaacaaagctgtagctgctaa

DBGET integrated database retrieval system