Tachysurus fulvidraco (yellow catfish): 113646486 Help Entry 113646486         CDS       T08119                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04137   Mitophagy - animal tfd04140   Autophagy - animal tfd04144   Endocytosis tfd04145   Phagosome tfd04148   Efferocytosis tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113646486 (rab7b)    04145 Phagosome     113646486 (rab7b)    04140 Autophagy - animal     113646486 (rab7b)    04137 Mitophagy - animal     113646486 (rab7b)    04148 Efferocytosis     113646486 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113646486 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfd04131]     113646486 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113646486 (rab7b)    04031 GTP-binding proteins [BR:tfd04031]     113646486 (rab7b) Membrane trafficking [BR:tfd04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113646486 (rab7b) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113646486 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    113646486 (rab7b)   Exosomal proteins of colorectal cancer cells    113646486 (rab7b)   Exosomal proteins of bladder cancer cells    113646486 (rab7b) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113646486 (rab7b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 AAA_7 AAA_22 NTPase_1 G-alpha AAA_24 ATPase_2 AAA_5 SRPRB ATP-synt_ab AAA_14 ABC_tran NACHT DAP3 MCM Motif Other DBs NCBI-GeneID:  113646486 NCBI-ProteinID:  XP_027008585 LinkDB All DBs Position 14:complement(23116539..23126879) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQETEV EPYDFPDQIKLRDDRPATSNDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgtaaaaaggtgctgcttaaggtgatcatccttggtgattctggggtcgga aagacatctttaatgaaccagtatgttaacaacaagttcagcaaccagtacaaggccacg atcggcgccgactttctgaccaaagaggtgatggtggacgacaggctggtcaccatgcag atttgggacacagccggacaggagcgttttcagtctctgggcgtggcgttctacagaggc gctgactgctgcgtgctggtctacgatgtcacatctccaaacaccttcaagactctggat agctggagggatgagttcctgatccaagccagccctcgtgacccagagaactttcccttc gtcgtgctcgggaacaagatcgacttggagaacagacaggtcactacaaagcgagctcag gcctggtgtcaaagcaagaacaacatcccttattttgagaccagtgccaaagaagccatc aatgtggaccaggctttccaaaccattgctcgcaatgcactcaaacaggagaccgaggtg gagccctacgattttcccgaccagatcaagctaagagacgacagacctgccacctcgaac gatggctgcagctgctga

DBGET integrated database retrieval system