Tachysurus fulvidraco (yellow catfish): 113646609 Help Entry 113646609         CDS       T08119                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism tfd  Tachysurus fulvidraco (yellow catfish) Brite KEGG Orthology (KO) [BR:tfd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:tfd03041]     113646609 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tfd04052]     113646609 (ubl5) Spliceosome [BR:tfd03041]  Complex B   Other components    Complex B specific factors     113646609 (ubl5) Cytokines and neuropeptides [BR:tfd04052]  Neuropeptides   Unclassified    113646609 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  113646609 NCBI-ProteinID:  XP_027008774 LinkDB All DBs Position 18:complement(19546726..19548810) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggttgtatgtaacgatcgactgggcaaaaaagtccgagtcaaatgcaattct gaagacactatcggggatctgaagaagctaatcgctgctcagacaggaaccagatgggac aaaatcgtcttgaagaaatggtacactatatttaaggaccacgtgtcacttggtgactat gagatccatgatgggatgaacctggagctgtattaccagtag

DBGET integrated database retrieval system