Tachysurus fulvidraco (yellow catfish): 113646809 Help Entry 113646809         CDS       T08119                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04382   Cornified envelope formation tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     113646809 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113646809 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113646809 (s100a10b) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of microglial cells    113646809 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH NNH2 Bcl-2 SPARC_Ca_bdg DEK_C Motif Other DBs NCBI-GeneID:  113646809 NCBI-ProteinID:  XP_027009079 LinkDB All DBs Position 3:26081518..26083322 Genome browser AA seq 98 aa AA seqDB search MPSDLERAMETLITVFHRYAGKEGNSTTLSRKELRQLMESELSTFLKSQKDPATVDKIMK DLDTNGDGEVNFEEFVSLVVGLSIACEQCYQQHLKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagctatggaaacgctgatcacagtttttcaccgatatgct ggaaaagagggcaatagcaccacactgagccgcaaagagctcaggcagctcatggagtca gagctctccaccttccttaagtctcaaaaagaccctgccaccgttgacaagattatgaaa gatctggacaccaatggggatggagaggtgaactttgaagagtttgtgtcccttgtggtg ggtctgtccattgcctgtgaacagtgttaccagcagcaccttaaaggaaagaagtaa

DBGET integrated database retrieval system