Tachysurus fulvidraco (yellow catfish): 113648530 Help Entry 113648530         CDS       T08119                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04010   MAPK signaling pathway tfd04137   Mitophagy - animal tfd04140   Autophagy - animal tfd04218   Cellular senescence tfd04371   Apelin signaling pathway tfd04625   C-type lectin receptor signaling pathway tfd04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113648530 (rras)    04371 Apelin signaling pathway     113648530 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113648530 (rras)    04137 Mitophagy - animal     113648530 (rras)   09143 Cell growth and death    04218 Cellular senescence     113648530 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113648530 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113648530 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113648530 (rras)    04031 GTP-binding proteins [BR:tfd04031]     113648530 (rras) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113648530 (rras)   Exosomal proteins of bladder cancer cells    113648530 (rras) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113648530 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  113648530 NCBI-ProteinID:  XP_027011546 LinkDB All DBs Position 15:complement(23821438..23844205) Genome browser AA seq 197 aa AA seqDB search MTSEEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDIGSYNEIQKFHTQILRVKDRDDFPMVLVGN KSDLEHQRVVSREDAMSFAKENRIHYMESSAKNRYNVDEAFLEVVRAIRKFQETESPPQL ANHARKQKSGGCPCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagaagaggagcgatacaaactggtggtggtgggaggaggaggtgtgggtaag agtgccctcactatacagtttatccagtcgtacttcgtgtctgactacgacccgaccatc gaggactcgtacaccaaaatctgcaccgtggatgggaaggagacccgattagacatactg gacacagcaggtcaggaagagtttggggcgatgagagagcagtacatgcgatctggagaa ggcttcttactggtgtttgctctgaatgacattggaagctacaatgaaatccagaagttt cacactcagatcctgagggtaaaagatcgagatgatttccccatggtcctcgtcggcaac aagtctgatctggagcatcagagagtggtttccagagaagacgccatgtcttttgccaaa gaaaaccggatccactacatggagtcgtcagcgaagaaccgctacaacgtggatgaagct tttctggaggtggtgcgagcaataagaaagtttcaggagacagaaagtcctcctcagctt gcgaatcacgccaggaagcagaagagcggcgggtgtccctgcaccatcctctga

DBGET integrated database retrieval system