Tachysurus fulvidraco (yellow catfish): 113653819 Help Entry 113653819         CDS       T08119                                  Name (RefSeq) histone H2B-like isoform X1   KO K11252   histone H2B Organism tfd  Tachysurus fulvidraco (yellow catfish) Brite KEGG Orthology (KO) [BR:tfd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tfd03036]     113653819   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113653819 Chromosome and associated proteins [BR:tfd03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113653819 Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113653819 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  113653819 NCBI-ProteinID:  XP_047657373 LinkDB All DBs Position 1:complement(43093858..43136186) Genome browser AA seq 91 aa AA seqDB search MGITDSFVDDIVERIALESSCPPRHNNPATYKDIQTAVRLLLLGELRVALAAQQQEPLPQ NFTSSAPLAADCSRTQPLIMNRYATKNTVAE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgggcatcacggactcgttcgtcgacgacattgttgagcgcatcgcccttgagtcttct tgtccgcctcgccacaacaaccccgccacctataaggacatccagactgccgtgcgtctg ttgcttctcggagagttgagggtcgccctggcagctcagcagcaggagccgctgccacag aatttcacttcctctgctccacttgccgctgattgctccaggactcaacctctcatcatg aataggtatgccaccaaaaacacggttgctgaatag

DBGET integrated database retrieval system