Tachysurus fulvidraco (yellow catfish): 113655080 Help Entry 113655080         CDS       T08119                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd03030   DNA replication tfd03082   ATP-dependent chromatin remodeling tfd03410   Base excision repair tfd03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113655080 (pole3)    03410 Base excision repair     113655080 (pole3)    03420 Nucleotide excision repair     113655080 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113655080 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tfd03032]     113655080 (pole3)    03036 Chromosome and associated proteins [BR:tfd03036]     113655080 (pole3)    03400 DNA repair and recombination proteins [BR:tfd03400]     113655080 (pole3) Enzymes [BR:tfd01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      113655080 (pole3) DNA replication proteins [BR:tfd03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     113655080 (pole3) Chromosome and associated proteins [BR:tfd03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     113655080 (pole3) DNA repair and recombination proteins [BR:tfd03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       113655080 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 DUF4746 CIS_TMP RNA_pol_3_Rpc31 PPP4R2 ECM10 Bromo_TP CDC45 PFF1_TM Motif Other DBs NCBI-GeneID:  113655080 NCBI-ProteinID:  XP_027021172 LinkDB All DBs Position 26:8678429..8681474 Genome browser AA seq 150 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANSFAMKAK RKTLNAGDVMSAMEEMEFERFLPPLREALEAYKKGQKGKKEASEQKRKDKEKKNGTEEND KSREEEEEEEEHMEDEQDGENEGDEEDVEN NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccagaggacctgaacttgcccaacgctgtcatcacccgcattatcaag gaggctttaccagatggtgtcaatgtgtccaaagaggcaagaagagcgatatctcaagca gccagcgtatttgttttatatgcaacatcatgtgccaacagttttgctatgaaagccaaa aggaagactctaaatgctggggatgtgatgtccgctatggaggagatggagtttgagcgt ttcttgccacctctgcgtgaggctctcgaggcctacaaaaagggccagaaggggaaaaaa gaggcgtcggagcagaaacgcaaggacaaagagaagaagaacggcacagaggaaaatgac aagagcagagaggaagaagaagaggaagaggagcacatggaggatgagcaggatggagag aatgagggagatgaggaggatgtggagaactga

DBGET integrated database retrieval system