Tachysurus fulvidraco (yellow catfish): 113657511 Help Entry 113657511         CDS       T08119                                  Name (RefSeq) protein BTG1-like   KO K14443   protein Tob/BTG Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd03018   RNA degradation Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     113657511  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tfd03019]     113657511 Messenger RNA biogenesis [BR:tfd03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      113657511   mRNA degradation factors    3'-5' decay     Other 3'-5' decay factors      113657511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BTG Motif Other DBs NCBI-GeneID:  113657511 NCBI-ProteinID:  XP_027025214 LinkDB All DBs Position 1:30634622..30635876 Genome browser AA seq 117 aa AA seqDB search MRTEVSTAANFVSSLVRMTGLLSEDQLNHLNFSLQKTLLEYYEQHWFPQDPCRGSGYRCL CINHKMDPLIGKAAWAVGITREEIFSLLPCELTLWVDPNEVSYRIGENGPSCVLYAS NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgagaacagaagtctctacagctgctaattttgttagcagtctggtcaggatgactggc cttcttagtgaagatcagcttaatcacttaaacttttccctacagaagacgctacttgag tactacgagcaacactggtttccccaagacccttgcagagggtcaggctacagatgcttg tgcatcaaccacaaaatggaccctttgataggcaaagctgcctgggccgttggcattaca cgggaggaaatcttttccctgcttccttgtgagctaacactgtgggtggacccgaatgaa gtgtcgtatcgcattggtgaaaatggacccagttgtgttctttatgcgtcctga

DBGET integrated database retrieval system