Tachysurus fulvidraco (yellow catfish): 113658691 Help Entry 113658691         CDS       T08119                                  Symbol sumo2a Name (RefSeq) small ubiquitin like modifier 2a   KO K12160   small ubiquitin-related modifier Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd03013   Nucleocytoplasmic transport Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     113658691 (sumo2a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tfd04121]     113658691 (sumo2a)    03029 Mitochondrial biogenesis [BR:tfd03029]     113658691 (sumo2a)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tfd04812]     113658691 (sumo2a) Ubiquitin system [BR:tfd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    113658691 (sumo2a) Mitochondrial biogenesis [BR:tfd03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     113658691 (sumo2a) Cytoskeleton proteins [BR:tfd04812]  Eukaryotic cytoskeleton proteins   Septins    Septin associated proteins     113658691 (sumo2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rad60-SLD ubiquitin SRP9-21 Motif Other DBs NCBI-GeneID:  113658691 NCBI-ProteinID:  XP_027027027 UniProt:  A0A3G6ZHP6 LinkDB All DBs Position 5:complement(33864855..33867498) Genome browser AA seq 95 aa AA seqDB search MADEKPKEGVKTENNEHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLTMRQIRF RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVI NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcggacgagaagcccaaggaaggagtgaagactgaaaataacgaacacatcaacctg aaggtggcgggacaggacggctcggtggtgcagttcaaaatcaagaggcatacgccgctc agcaaactgatgaaggcctactgtgaacgacagggactcacaatgaggcagatccgcttc cggtttgatggacagcccattaacgagacggacacgcctgctcagttggaaatggaggac gaggacacgatcgatgtgtttcagcagcagacaggaggtgtgatttga

DBGET integrated database retrieval system