Tachysurus fulvidraco (yellow catfish): 113659242 Help Entry 113659242         CDS       T08119                                  Symbol cenpx Name (RefSeq) centromere protein X isoform X2   KO K15360   centromere protein X Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     113659242 (cenpx)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:tfd03400]     113659242 (cenpx) DNA repair and recombination proteins [BR:tfd03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      113659242 (cenpx) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF TFIID-18kDa RRM_MARF1 Motif Other DBs NCBI-GeneID:  113659242 NCBI-ProteinID:  XP_027027718 LinkDB All DBs Position 15:8331940..8337385 Genome browser AA seq 81 aa AA seqDB search MVDQAREVIFKKETVSKLLMLFFKDDKSKVSNDSVSLMAEMLRIFVIEATRRAIKHAENE DCVGVDLEHVEKILPQLLLDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggttgatcaagcgcgcgaagtaattttcaaaaaggaaaccgtcagcaaacttttaatg ctgttctttaaggacgacaaaagcaaagtcagcaacgattctgtcagtctcatggctgag atgctgagaattttcgttatcgaagcaacacgcagagcaataaaacatgcagagaatgaa gactgtgttggtgtggatttggaacatgttgagaaaattttgcctcagctgcttttggat ttctga

DBGET integrated database retrieval system