Tachysurus fulvidraco (yellow catfish): 113660166 Help Entry 113660166         CDS       T08119                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04010   MAPK signaling pathway tfd04012   ErbB signaling pathway tfd04068   FoxO signaling pathway tfd04137   Mitophagy - animal tfd04140   Autophagy - animal tfd04144   Endocytosis tfd04150   mTOR signaling pathway tfd04210   Apoptosis tfd04218   Cellular senescence tfd04370   VEGF signaling pathway tfd04371   Apelin signaling pathway tfd04510   Focal adhesion tfd04540   Gap junction tfd04625   C-type lectin receptor signaling pathway tfd04810   Regulation of actin cytoskeleton tfd04910   Insulin signaling pathway tfd04912   GnRH signaling pathway tfd04916   Melanogenesis tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113660166 (hrasa)    04012 ErbB signaling pathway     113660166 (hrasa)    04370 VEGF signaling pathway     113660166 (hrasa)    04371 Apelin signaling pathway     113660166 (hrasa)    04068 FoxO signaling pathway     113660166 (hrasa)    04150 mTOR signaling pathway     113660166 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113660166 (hrasa)    04140 Autophagy - animal     113660166 (hrasa)    04137 Mitophagy - animal     113660166 (hrasa)   09143 Cell growth and death    04210 Apoptosis     113660166 (hrasa)    04218 Cellular senescence     113660166 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     113660166 (hrasa)    04540 Gap junction     113660166 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113660166 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113660166 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     113660166 (hrasa)    04912 GnRH signaling pathway     113660166 (hrasa)    04916 Melanogenesis     113660166 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113660166 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfd04131]     113660166 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113660166 (hrasa)    04031 GTP-binding proteins [BR:tfd04031]     113660166 (hrasa) Membrane trafficking [BR:tfd04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113660166 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     113660166 (hrasa) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113660166 (hrasa)   Exosomal proteins of colorectal cancer cells    113660166 (hrasa) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113660166 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  113660166 NCBI-ProteinID:  XP_027029281 LinkDB All DBs Position 10:complement(13441464..13456805) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAHELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataaactggtggtggtgggagctggaggcgtgggcaagagcgctcttacc atccaactcatccagaaccactttgtggatgaatatgaccctaccatagaggactcgtac aggaagcaggtggtgattgacggtgagacatgcttgttggacatcctggacacagcaggt caagaggagtacagtgccatgagggaccagtacatgagaacaggagaaggcttcctctgt gtctttgccatcaataacaccaagtcatttgaggacattcatcagtacagggaacaaatc aagcgggtaaaggactctgacgacgtgccaatggtgcttgtgggtaataaatgtgacctt ccagctcgcacagtggacacacggcaagcacacgagcttgcacgcagctacggcatccct tacatcgaaacctcagccaagactagacaaggagtggaggatgctttctacacactagta cgggagatccgacagcacaaactgaggaaactcaatcctccagatgaaagtggacaggac tgcatgagctgtcgctgcgtggtgtcatga

DBGET integrated database retrieval system