Tachysurus fulvidraco (yellow catfish): 113661079 Help Entry 113661079         CDS       T08119                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism tfd  Tachysurus fulvidraco (yellow catfish) Brite KEGG Orthology (KO) [BR:tfd00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:tfd01002]     113661079   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113661079 Peptidases and inhibitors [BR:tfd01002]  Peptidase inhibitors   Family I25: cystatin family    113661079 Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113661079 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Bac_small_YrzI Motif Other DBs NCBI-GeneID:  113661079 NCBI-ProteinID:  XP_027030842 LinkDB All DBs Position 25:15012272..15013637 Genome browser AA seq 100 aa AA seqDB search MPLLCGGTSEEKEANEEVQKICDEMKSHAEEKAGRTFDVFTAKSYKTQVVAGTNFFIKVH VGGEEFAHLRVYKMLPHAGEKLELHGIQTPKAHHDPIEYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcctttgttatgcggagggaccagtgaggagaaggaggccaatgaagaagtgcagaaa atctgtgatgagatgaagtcacatgcagaggaaaaagctggaaggacatttgatgtcttt actgctaaatcttacaagacgcaggtggtagctgggacaaatttcttcatcaaggtccat gtgggtggtgaggagtttgctcacctgcgtgtctataagatgttgccacatgctggagaa aaactggaacttcatggaatacagacacccaaagcccatcatgacccaattgaatacttc taa

DBGET integrated database retrieval system