Tachysurus fulvidraco (yellow catfish): 113663028 Help Entry 113663028         CDS       T08119                                  Symbol cxcl8b.3 Name (RefSeq) interleukin-8b.3 isoform X1   KO K10030   interleukin 8 Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04060   Cytokine-cytokine receptor interaction tfd04218   Cellular senescence tfd04620   Toll-like receptor signaling pathway tfd04621   NOD-like receptor signaling pathway tfd04622   RIG-I-like receptor signaling pathway tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113663028 (cxcl8b.3)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113663028 (cxcl8b.3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113663028 (cxcl8b.3)    04621 NOD-like receptor signaling pathway     113663028 (cxcl8b.3)    04622 RIG-I-like receptor signaling pathway     113663028 (cxcl8b.3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113663028 (cxcl8b.3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tfd04052]     113663028 (cxcl8b.3)    00536 Glycosaminoglycan binding proteins [BR:tfd00536]     113663028 (cxcl8b.3) Cytokines and neuropeptides [BR:tfd04052]  Cytokines   Chemokines    113663028 (cxcl8b.3) Glycosaminoglycan binding proteins [BR:tfd00536]  Heparan sulfate / Heparin   Chemokines    113663028 (cxcl8b.3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 tRNA_SAD Motif Other DBs NCBI-GeneID:  113663028 NCBI-ProteinID:  XP_027034061 LinkDB All DBs Position 1:39531320..39532552 Genome browser AA seq 92 aa AA seqDB search MNFAALVITFLACALFSMTEGLFIQQPRCQCTKTIPMKFPDHIIVKMGKFEPGPHCKNTE IIATVKLIKLFTWCLNPNDERVQDALKRRNLA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacttcgcagctctagttatcacttttttagcctgtgcactcttctcaatgacagaa ggactttttatccaacagccccgatgtcagtgtacaaaaacaataccaatgaaattccct gatcatataattgtgaagatggggaaatttgaacctggtcctcactgcaaaaatacagaa ataattgctacagtgaaactgataaaattatttacttggtgcctaaaccctaatgatgag cgggttcaggatgcactcaaaagaaggaacctggcataa

DBGET integrated database retrieval system