Tachysurus fulvidraco (yellow catfish): 113663147 Help Entry 113663147         CDS       T08119                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04621   NOD-like receptor signaling pathway tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     113663147 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113663147 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tfd03110]     113663147 (txn) Chaperones and folding catalysts [BR:tfd03110]  Protein folding catalysts   Protein disulfide isomerase    113663147 (txn) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_9 AhpC-TSA Thioredoxin_7 Thioredoxin_2 Thioredoxin_8 DIM1 Redoxin Motif Other DBs NCBI-GeneID:  113663147 NCBI-ProteinID:  XP_027034119 LinkDB All DBs Position 1:complement(38960823..38965329) Genome browser AA seq 107 aa AA seqDB search MVIVIGNKRDFDAALKNAGDKLVVVDFTATWCGPCQMIGPIFKAMSESPENKDVVFLKVD VDEAQDVSSSCGIRCMPTFQFYKRGEKLEEFSGANKDTLEKTIAKHR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggttatagttatcggaaacaagcgagattttgatgcagccctgaaaaatgcaggggac aaattagtggtagtggacttcacagccacatggtgcggcccgtgccaaatgattggcccc atctttaaagctatgtctgaaagtccagaaaataaggatgtagtttttctgaaggtggat gtggacgaagcacaggatgtatccagttcatgtgggatccgatgcatgccgactttccaa ttctacaagcgaggggaaaagctggaggagttttctggggccaacaaagatacgctggaa aaaacgatcgccaaacatagatga

DBGET integrated database retrieval system