Tachysurus fulvidraco (yellow catfish): 125138703 Help Entry 125138703         CDS       T08119                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125138703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tfd04121]     125138703    03400 DNA repair and recombination proteins [BR:tfd03400]     125138703 Ubiquitin system [BR:tfd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      125138703    Cul5 complex      125138703 DNA repair and recombination proteins [BR:tfd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      125138703 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  125138703 NCBI-ProteinID:  XP_047656758 LinkDB All DBs Position 15:23520173..23526696 Genome browser AA seq 114 aa AA seqDB search MIRRHKTTIFTDAKESTTVYELKRIVEGILKRVPEEQRLYKDDMLLEDSKTLGDYGFTNQ TARPQAPATVGLAFRISDEVFEPLRVDTFSSPPELPDVMKPQDSGSTGNEQAVQ NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgatccgacgtcacaagacgaccatcttcacagacgccaaggagtcgaccacagtgtat gagctgaagcgcatcgtggagggtatactgaagagagtgcctgaggagcagagactgtac aaggatgacatgttgttagaagacagtaagacacttggagattacggtttcacaaaccag acagcgagacctcaggctcctgctacagtgggactcgccttccgcatcagcgacgaagtg tttgaacctctgcgtgtggacactttctccagtcctccagagctgccagatgtgatgaag ccccaggactcgggcagcacggggaacgagcaggctgtacagtga

DBGET integrated database retrieval system