Tachysurus fulvidraco (yellow catfish): 125139655 Help Entry 125139655         CDS       T08119                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism tfd  Tachysurus fulvidraco (yellow catfish) Brite KEGG Orthology (KO) [BR:tfd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tfd03036]     125139655   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     125139655 Chromosome and associated proteins [BR:tfd03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125139655 Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125139655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  125139655 NCBI-ProteinID:  XP_047660293 LinkDB All DBs Position 19:complement(988111..988350) Genome browser AA seq 67 aa AA seqDB search MGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggcatcatgaactcgttcgtcaacgacatttttgagcgcatcgccggtgagtcttct cgtctggctcactacaacaagcgctccaccatcacctctagggagatccagactgccgtg cgtctgttgcttcccggagagttggccaagcacgccgtgtctgagggcacaaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system