KEGG   Trachypithecus francoisi (Francois's langur): 117069878
Entry
117069878         CDS       T07225                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
tfn  Trachypithecus francoisi (Francois's langur)
Pathway
tfn04014  Ras signaling pathway
tfn04015  Rap1 signaling pathway
tfn04020  Calcium signaling pathway
tfn04022  cGMP-PKG signaling pathway
tfn04024  cAMP signaling pathway
tfn04070  Phosphatidylinositol signaling system
tfn04114  Oocyte meiosis
tfn04218  Cellular senescence
tfn04261  Adrenergic signaling in cardiomyocytes
tfn04270  Vascular smooth muscle contraction
tfn04371  Apelin signaling pathway
tfn04625  C-type lectin receptor signaling pathway
tfn04713  Circadian entrainment
tfn04720  Long-term potentiation
tfn04722  Neurotrophin signaling pathway
tfn04728  Dopaminergic synapse
tfn04740  Olfactory transduction
tfn04744  Phototransduction
tfn04750  Inflammatory mediator regulation of TRP channels
tfn04910  Insulin signaling pathway
tfn04912  GnRH signaling pathway
tfn04915  Estrogen signaling pathway
tfn04916  Melanogenesis
tfn04921  Oxytocin signaling pathway
tfn04922  Glucagon signaling pathway
tfn04924  Renin secretion
tfn04925  Aldosterone synthesis and secretion
tfn04970  Salivary secretion
tfn04971  Gastric acid secretion
tfn05010  Alzheimer disease
tfn05012  Parkinson disease
tfn05022  Pathways of neurodegeneration - multiple diseases
tfn05031  Amphetamine addiction
tfn05034  Alcoholism
tfn05133  Pertussis
tfn05152  Tuberculosis
tfn05163  Human cytomegalovirus infection
tfn05167  Kaposi sarcoma-associated herpesvirus infection
tfn05170  Human immunodeficiency virus 1 infection
tfn05200  Pathways in cancer
tfn05214  Glioma
tfn05417  Lipid and atherosclerosis
tfn05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tfn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    117069878
   04015 Rap1 signaling pathway
    117069878
   04371 Apelin signaling pathway
    117069878
   04020 Calcium signaling pathway
    117069878
   04070 Phosphatidylinositol signaling system
    117069878
   04024 cAMP signaling pathway
    117069878
   04022 cGMP-PKG signaling pathway
    117069878
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    117069878
   04218 Cellular senescence
    117069878
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117069878
  09152 Endocrine system
   04910 Insulin signaling pathway
    117069878
   04922 Glucagon signaling pathway
    117069878
   04912 GnRH signaling pathway
    117069878
   04915 Estrogen signaling pathway
    117069878
   04921 Oxytocin signaling pathway
    117069878
   04916 Melanogenesis
    117069878
   04924 Renin secretion
    117069878
   04925 Aldosterone synthesis and secretion
    117069878
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117069878
   04270 Vascular smooth muscle contraction
    117069878
  09154 Digestive system
   04970 Salivary secretion
    117069878
   04971 Gastric acid secretion
    117069878
  09156 Nervous system
   04728 Dopaminergic synapse
    117069878
   04720 Long-term potentiation
    117069878
   04722 Neurotrophin signaling pathway
    117069878
  09157 Sensory system
   04744 Phototransduction
    117069878
   04740 Olfactory transduction
    117069878
   04750 Inflammatory mediator regulation of TRP channels
    117069878
  09159 Environmental adaptation
   04713 Circadian entrainment
    117069878
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117069878
  09162 Cancer: specific types
   05214 Glioma
    117069878
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117069878
   05163 Human cytomegalovirus infection
    117069878
   05167 Kaposi sarcoma-associated herpesvirus infection
    117069878
  09171 Infectious disease: bacterial
   05133 Pertussis
    117069878
   05152 Tuberculosis
    117069878
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117069878
   05012 Parkinson disease
    117069878
   05022 Pathways of neurodegeneration - multiple diseases
    117069878
  09165 Substance dependence
   05031 Amphetamine addiction
    117069878
   05034 Alcoholism
    117069878
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117069878
   05418 Fluid shear stress and atherosclerosis
    117069878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tfn01009]
    117069878
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tfn04131]
    117069878
   03036 Chromosome and associated proteins [BR:tfn03036]
    117069878
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tfn04147]
    117069878
Protein phosphatases and associated proteins [BR:tfn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     117069878
Membrane trafficking [BR:tfn04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    117069878
Chromosome and associated proteins [BR:tfn03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     117069878
Exosome [BR:tfn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   117069878
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 EF-hand_EFHB_C EFhand_Ca_insen SAPC2_N DUF5580_M BamM_C UPF0154 Caleosin Dockerin_1 DUF1103 FCaBP_EF-hand SPEF2_C Phage_tail_S SurA_N_3 Fe_hyd_lg_C TFIIS_M
Other DBs
NCBI-GeneID: 117069878
NCBI-ProteinID: XP_033044257
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIEEFKEAFSLFDKDGDGIITTKELGTVMRSLGQNLTEAELQDMINEVDADG
NGTVDFPEFLTMTARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccaactgaccgaagagcagattgaagaattcaaagaagctttttcactattt
gacaaagatggtgatggaattataacaacaaaggaattgggaactgtaatgaggtctctt
gggcagaatctcacagaagcagagttacaggacatgattaatgaagtagatgctgatggt
aatggcacagttgacttccctgaatttctgacaatgacggcaagaaaaatgaaagacaca
gacagtgaagaagaaattagagaagcgttccgtgtgtttgataaggatggcaatggctat
attagtgctgcagaacttcgccatgtgatgacaaaccttggagagaagttaacagatgaa
gaagttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa
gaatttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system