KEGG   Trachypithecus francoisi (Francois's langur): 117095694
Entry
117095694         CDS       T07225                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
tfn  Trachypithecus francoisi (Francois's langur)
Pathway
tfn04927  Cortisol synthesis and secretion
tfn04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:tfn00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    117095694 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    117095694 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 117095694
NCBI-ProteinID: XP_033088197
LinkDB
Position
Unknown
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPQMKNSPKHHQTCLWSHSLSLQLCIQKCLPCHREPLGTSQAQASSVEPGSRTGPD
QPLRQGSASTLPLGVFQTHPTLLWELTLNGGPLVRNKPSEPPPGDRTPQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaatgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtcgggctccccgcagatgaagaacagtcccaagcaccaccagacatgcctctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggggacctcacaggctcaggcgagttcagtggagccagggagcagaactggccctgac
cagccgctacgacaggggagcgcctccaccttgccccttggggttttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcgtcaggaacaagcccagcgag
cctccccctggagacaggacccctcaattgcagagctga

DBGET integrated database retrieval system