Thermanaerosceptrum fracticalcis: BR63_04255 Help Entry BR63_04255        CDS       T06762                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tfr  Thermanaerosceptrum fracticalcis Pathway tfr00020   Citrate cycle (TCA cycle) tfr00720   Other carbon fixation pathways tfr01100   Metabolic pathways tfr01110   Biosynthesis of secondary metabolites tfr01120   Microbial metabolism in diverse environments tfr01200   Carbon metabolism tfr01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tfr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BR63_04255   09102 Energy metabolism    00720 Other carbon fixation pathways     BR63_04255 Enzymes [BR:tfr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BR63_04255 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_7 Fer4_9 Fer4_21 Fer4_16 Fer4_13 Fer4_4 Fer4_8 Fer4_17 Fer4_15 Fer4_3 LdpA_Fe-S-bd Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  QNB45598 UniProt:  A0A7G6E0J4 LinkDB All DBs Position 818434..818655 Genome browser AA seq 73 aa AA seqDB search MGEVNKETKKYTVEVKQQWCKSCGICYALCPKGVLIKDQLGKAVVKDPALCIGCRICEEH CPDYCIKIGGEEK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgggagaagtgaacaaagagacaaaaaaatatactgttgaggttaaacaacaatggtgt aaaagctgtggtatttgttatgccttatgtcctaaaggcgtactaatcaaggaccagctg ggcaaagctgtagtcaaagaccctgctctatgtattggctgcaggatttgtgaagaacat tgtcctgactactgtattaaaattgggggtgaagaaaagtga

DBGET integrated database retrieval system