Thiorhodovibrio frisius: Thiofri_00828 Help Entry Thiofri_00828     CDS       T09561                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism tfri  Thiorhodovibrio frisius Pathway tfri01100   Metabolic pathways tfri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tfri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Thiofri_00828 (acpP)    00074 Mycolic acid biosynthesis     Thiofri_00828 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Thiofri_00828 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1493 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  WPL20723 LinkDB All DBs Position 768766..769002 Genome browser AA seq 78 aa AA seqDB search MSSVEERVQKIVVEQLGVKEEEVTPEASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKITTVKQAVDYINAHSG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgttgaagagcgagtccagaaaattgtcgtcgaacagttgggcgtcaaggaa gaggaagtcaccccggaggcttccttcgttgacgatctcggtgccgattcgctcgatact gtcgaactggtcatggcacttgaagaggagttcgaaaccgaaatccccgacgaggatgcc gagaagatcaccaccgtcaagcaggcggtcgattacattaacgcccattcggggtaa

DBGET integrated database retrieval system