Takifugu flavidus (sansaifugu): 130513520 Help Entry 130513520         CDS       T09160                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs03082   ATP-dependent chromatin remodeling tfs04217   Necroptosis Brite KEGG Orthology (KO) [BR:tfs00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     130513520  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     130513520  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tfs03036]     130513520   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfs04147]     130513520 Chromosome and associated proteins [BR:tfs03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130513520 Exosome [BR:tfs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130513520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  130513520 NCBI-ProteinID:  XP_056868283 LinkDB All DBs Position 17:10496449..10496903 Genome browser AA seq 125 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgagcggtcgcgggaaaaccggtggcaaagccagagctaaggccaagactcgctcttct cgggccgggctccagttcccagtgggccgtgttcacaggctgctccgcaagggcaactat gctgagcgcgttggcgccggcgctcctgtgtacctggccgctgtgctggagtatctgacg gctgagatcctggagttggctggcaacgctgcccgcgacaacaagaagactcgcatcatc ccccgccacctgcagctggctgtgcgcaacgacgaggagctgaacaagctgctgggagga gtgacgatcgctcagggcggcgtgttgcccaacatccaggctgtcctgctgcccaagaag accgagaaggccaaataa

DBGET integrated database retrieval system