Takifugu flavidus (sansaifugu): 130515309 Help Entry 130515309         CDS       T09160                                  Symbol elob Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tfs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     130515309 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tfs04121]     130515309 (elob)    03400 DNA repair and recombination proteins [BR:tfs03400]     130515309 (elob) Ubiquitin system [BR:tfs04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      130515309 (elob)    Cul5 complex      130515309 (elob) DNA repair and recombination proteins [BR:tfs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      130515309 (elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  130515309 NCBI-ProteinID:  XP_056871468 LinkDB All DBs Position 18:11596691..11599019 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDLLLSDGQTLGNC GFTNQTARPQAPATVGLAFRLGDDTFEQLRVEPFSTPPELPDVMKPQDSGSTANEQVVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttcttatgattcgacgtcataagacgacgatcttcaccgacgccaaagag tccaccaccgtttacgagctgaagcgcatcgtggaagggatcctgaagaggccgcctgag gaccagaggctttacaaggacgacttgttgctgagcgacggacagacgttaggaaactgc ggcttcaccaaccagacggcgcggcctcaggccccggccacggtgggcttggccttccgc ctgggggatgacacgttcgagcagctgagggtggagcctttctccaccccccctgagctc cccgacgtcatgaagccgcaggactctggcagcacagccaacgagcaggtcgtccagtga

DBGET integrated database retrieval system