Takifugu flavidus (sansaifugu): 130517362 Help Entry 130517362         CDS       T09160                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04115   p53 signaling pathway tfs04137   Mitophagy - animal tfs04140   Autophagy - animal tfs04210   Apoptosis tfs04621   NOD-like receptor signaling pathway tfs05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tfs00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130517362    04137 Mitophagy - animal     130517362   09143 Cell growth and death    04210 Apoptosis     130517362    04115 p53 signaling pathway     130517362  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     130517362  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     130517362  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tfs01009]     130517362   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tfs03036]     130517362   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tfs02000]     130517362 Protein phosphatases and associated proteins [BR:tfs01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      130517362 Chromosome and associated proteins [BR:tfs03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     130517362 Transporters [BR:tfs02000]  Other transporters   Pores ion channels [TC:1]    130517362 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 TraD Bcl-2_3 Motif Other DBs NCBI-GeneID:  130517362 NCBI-ProteinID:  XP_056875168 LinkDB All DBs Position 20:complement(9618309..9620295) Genome browser AA seq 191 aa AA seqDB search MSNRELVENYLIYKLSQKYPGTVSPPAGTGREALNAALRSMANKYEQDFMEQAGDLSPYV AVTRNKAGFNKVMDDMFRDEINWGTVVGLFVVGGATYVQSFEGGASEPVCHVADWMTDYL DQRINPWIESQGGWDCFVTIYGEDACTNRAQEDRRKWILGGLVVLAGVLIIVTKNYGTLR KAFSNFMSYWS NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgtctaatagagagctggtagagaactatttaatctacaaactctctcagaaataccca ggcactgtgtctccacccgcaggtactggcagagaggctttgaatgcagctcttcggagc atggcaaataagtacgagcaggactttatggagcaagcgggtgacctctccccatacgtc gccgtgactaggaacaaggcaggttttaacaaggtgatggacgacatgttcagagatgaa atcaactggggaacagttgtaggtctttttgtcgtgggcggcgccacttatgtgcaatct ttcgagggcggcgcaagtgaaccggtttgccacgttgcagactggatgacagattacctg gaccaacggattaatccatggatcgagagtcaaggaggatgggactgctttgttaccatt tatggggaagacgcctgcacaaacagagctcaggaagacaggcgtaaatggatactgggc ggactggtggtgctggctggtgttttgatcattgttacaaaaaattatggtacattgcgt aaggcattttcaaattttatgtcttattggtcatag

DBGET integrated database retrieval system